horvd-f2cqv0

Hordeum vulgare var. distichum (Domesticated barley). Predicted protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Hordeum vulgare var. distichum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAAVTEQLLLPHEQHRRRPARVLAVTVSVAVVLLLLLVVV
PASLLRRTLL GAPSTDRVALTLLAGAKEKGAVCLDGTPP
GYHLQRGSGEGADRWLVHLEG GGWCSTVKECSDRRLSSQ
GSSNFMRSIRFMGNGILGGDQLQNPDFYNWNK VYVRYCD
GASFSGDAEAQAEDGTTLYFRGLRIYEAVIDELMEKGLAS
ATQ ALFTGCSAGALSMMLHCDDFRARFPQEVSVKCFADA
GFFIDEKDISGKRS LWSLYDRVIHLQNVRKVLPKDCLAN
KEPTECFFPAELIKSIRTPMFILNP SYDSWQIRNVLVPD
SSAPDKSWLSCKENIRNCNSTQVEVLNGLRNKMVND LKV
VEDKEDWGMFIDSCFTHCQSLSGISWHSPTSPRLENKTIA
EAVGDWH SGRSQGAKEIDCKYQCNPTCNSLPPPRDVTAF
DRVEIY

References