maize-a0a3l6efm3

Zea mays (Maize) Putative lysophospholipase BODYGUARD 3

Comment

Relationship

Family : Bodyguard

Block : X

Position in NCBI Life Tree : Zea mays

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MHIATCVWQEKAAPAGGMGGARVAGGGGGGEWGARAAAAL
GVAGRALNCA VSFVVFSALDVLDVVLCLAYKLADYAAEA
EWRPCYCSAAAGPRVAQQLHP KPKVVRLSAASPARLHLQ
LEDVSDTLYARPSLLADATRAGGDGVAPALTV SPAAIAA
LIREKTDRAPRAPRQTPCWSDCDCKVCHAWSGTSPASSSH
LYV HVQAPAAMPMGVETEDVVFIHGFISSSAFWTETVFP
AFSPAARSRYRMFA VDLLGFGRSPKPAESLYTLREHVEM
IERSVLRRYRLGSFHVVAHSLGSVL ALALAVKYPAAVKS
LTLLAPPYFPVPESEAESAAQYVMRRVAPRRVWPPI AFG
ASVACWYEHVSRTICLAICRHHRVWDRLFRIVTRNRVRSF
LIEAFMC HTHNAAWHTLHNVVCGGAGRMGAYLDAVDRRL
SCKVALFHGRDDELVPVG CTLAAGARVRRARVTVYERKD
HITIVVGQERLFAAELEAIWSADQ

References

No reference