nicat-a0a1j6hte1

Nicotiana attenuata (Coyote tobacco). Lipase_3 domain-containing protein

Comment

Relationship

Family : Triacylglycerol-lipase-OBL1-like

Block : L

Position in NCBI Life Tree : Nicotiana attenuata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MADKEEFCKGYFELKPEEASFFDFIRIFYSSELDKRNFFD
VSAGVERIGG FRRRWLIFISVILQRFLFWFKKPMASLGS
IVELMQNYPSFNGGFLQLLLN IIQGKAVTPEKSSEKFRS
MIGNLDVRVELDKKIKIGDSRYNAHLSIMAAK LSYENEA
LNKTVINHHWQMHFLGLHNFWNAYEEQYSTQATMFEDKIE
DPN LVVVAFRGTSPFYADAWITDIDLSWYDLEGMGKIHA
GFMKALGLQKNIGW PKEINDQENQQQNNKLFAYYKIRDD
LKKILNKNEKAKFIVTGHSLGGALA ILFAAILALHEEDW
LLDKLEGVYTFGQPRVGDEQFGNFMMEKFKKCDVKY FRY
VYCNDMVPRLPYDDKTLFFKHFGSCLYYNSLYNGKVLEEE
PNKNYFS LLWVLPKVVNAAFELIRSFIFPWIKGTDYRQS
WSEIIFRMVGLVIPGLSA HGPVDYVNLTRLGSILHLPQS
TRQGCLKHD

References

No reference