nicat-a0a1j6inz7

Nicotiana attenuata (Coyote tobacco). Lipase_3 domain-containing protein

Comment

Relationship

Family : Triacylglycerol-lipase-OBL1-like

Block : L

Position in NCBI Life Tree : Nicotiana attenuata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTQMMDRHNKVEKVSSNKYLQLKPDEASVLDLLRILFSGN
LKSKEFIESL RVKETAFERRGYIFLSVSVQKALRFISRP
LFFCGSISEFCLNLLARNQSL PTLLLRILQGKVVMPEKE
SASYLSAIGFIDPRVDCHNKFKPWDKTYVVAL SAIASKI
AYENKAFIRATVEDQWKMELLGAYDFWNEYHQTKSTQGFM
FHD KTSSPDRIIVAFRGTEPFNSDDWSTDFDISWYKFHS
IGKVHSGFMKAMGL QKDESWPANIPQDDQHPVAYYTIRE
KLRDYFEKNNKTKFVLTGHSLGGAL ALLFAAVLAFHNEA
IILERLEAIYTFGQPRVGDGEFGDFMKEQFKNYGIE YYR
FVYSHDIVTRLPYDNTSLHFKHFGTCLYYSSIYEGKIVSE
EPDRNYF SLRSLISKRVDALWELVRSFLLPYLYGTEYRE
SLLLQALRLYGLLFPGMP AHGPPEYINAICLGDATLFKA
PR

References

No reference