nicat-a0a1j6jf10

Nicotiana attenuata (Coyote tobacco). Uncharacterized protein

Comment

Relationship

Family : UCP031088

Block : X

Position in NCBI Life Tree : Nicotiana attenuata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVMVIQYNIGRSAIQIASAFRHCHISYHLACCVGVMRAFS
TATENSNSSA HNNKVSNKPPICTADELHYVSPNASDWRL
ALWRYLPPPQAPRRNHPLLLL SGVGTNAIGYDLSPESSF
ARYMCNQGFDTWILEVRGTGLSVQESDSKNIE KSAHTAS
NEKEAATDNANDRGHSASQQCTDVRGTSEKHDAALVKEEP
TVV STVWDESRVVTKLTEAFMRLSERVSGFVSGSQSKIV
SARLVHQISKLLEG SFLYKRVNAIRKKLLSLLETREKSA
VLTSQVGELSKKLVNIFEEGQRSVS SPLFDLQERLTTRI
GDFQEQLDLILKYDWDFDHYLEEDVPAAMEYIKVQT KPK
DDKLLAIGHSMGGILLYARLSWCGLEGREPGLAAVVTLAS
SLDYTSS KSALKLLLPLADPAQVLNVPVIPLRTLLAAAY
PLSSRAPYVLAWLNEMIS ATNMMHPDSLKKLVQNSFCNI
PAKLLLQLATAFQERGLRDRSGNIFYKDH LHKSSVPVLA
LAGDLDQICPPEAVYETVKLIPENLVTYKVFGDADGPHYA
HYDLVGGYMATEQLYPCVVQFLSRYDGTS

References

No reference