nicat-a0a1j6kss0

Nicotiana attenuata (Coyote tobacco, South American tobacco, Common tobacco); Nicotiana sylvestris (Wood tobacco); Nicotiana tabacum Uncharacterized protein

Comment

"Other strains: Nicotiana attenuata\; Nicotiana sylvestris (Wood tobacco)\; Nicotiana tabacum"

Relationship

Family : Bodyguard

Block : X

Position in NCBI Life Tree : Nicotiana attenuata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MSTMDKAKSIFIMTGRILNEAISFIVFSVLDILDFLLCYT
YKVIDFIVEA EWKPCYCSSAKEAMTSSGTILVSEQGESK
IVCLSTSSNRNKLQLEEISDT LYTRSSLVSEVSKSTVNE
LKRFKLENATVKKGTRMSTFTVNSTIVEMLQG KIGGQQY
HPIPRWSDCDCKTCNSWSSSCKDTLFVHVDGAKENVQENV
IFI HGFISSSAFWTETLFPNFTKAAKSKYRLFAVDLLGF
GRSPKPNDSLYTLR EHLDMIEKSVLEPYKVKSFHIVAHS
LGCILALALAVKHPGLVKSLTLLAP PYFPTPKEEQATQY
MMRRIAPRRVWPPIAFGASIACWYEHVSRTICLLIC KNH
RLWDFLTKLLTRNRIRTYLVEGFCCHTHNAAWHTLHNIIC
GTAGKIE GYLDMVKNHLKCEVTVFHGRDDELIPVECSYN
VQSRIPRAHVKVVENKDH ITIVVGRQQVFARELEQIWRN
NSTT

References

No reference