nicat-a0a1j6l7s7

Nicotiana attenuata (Coyote tobacco). Uncharacterized protein

Comment

Relationship

Family : UCP031088

Block : X

Position in NCBI Life Tree : Nicotiana attenuata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVAFAPSDFRWAIHAPAGLPSFSALEPAAAVGSPPHSLRP
LCISSSAGGR TSPKPSVCTADELHYVPLPNNEWKLALWR
YLPSPQRSRRNHPLLLLSGVG TNAIGYDLAPGSSFARYM
SHQGFDTWILEVRGAGLSAKISRDEGLQDATQ VSAISSQ
LREFGHGLGNIVEESQQPISQFTGLQSRFSITVGDFLKQL
HLI GKYNWDFDHYLEEDVPTAMDYIRNHCRPKDGKLLAI
GHSMGGILLYAMLS QNGSRGKCTELTSVITLGSSLDYTT
SRSSLKTLLPLVDPAKAVNLPVVPL GALLAAIYPLASHP
PYLLSWLNPQISAENMMHPEMFERLVLKNFCTIPAK LLS
QLSTVFQKGGLRNRSGTFLYKDHLHKSNVPVLAIAGDRDL
ICPPEAV YETAKLIPEGLVTYKVFGEPRGPNYGHYDLVG
GRMAFYQVYPYIIEFLSR HDRV

References

No reference