nicat-a0a314l3r6

Nicotiana attenuata (Coyote tobacco). Putative carboxylesterase 12

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Nicotiana attenuata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MDSNPTAAIAHEIPHFFRVYKDGRVERFRNHDFAPASDNP
QTGARSKDVV IVPENNVSVRFYLPKITQDDQKFPLIVYF
HGGGFTIESAFSTYYDSYLHS VAAETNVLAISVEYRLAP
EHKIPACYDDAWAVMKWVAQGTDPWLKTHADF SRVFLAG
DSAGANIAHNMMMRSSVDEDKHTIGLRLVGMALIHPFFGN
DEP DKIWTYICPENPRSDDPRFNPAVHPSLLSRLVCPKV
LICTAGSDFYKDRG WTYYEALKGSGWGGEVEIKETEGED
HVFHLVDTNCENARCLMKWLADFFH QTG

References

No reference