nicbe-j9y6p6

Nicotiana benthamiana Salicylic acid-binding protein 2

Comment

Relationship

Family : Hydroxynitrile_lyase

Block : X

Position in NCBI Life Tree : Nicotiana benthamiana

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKEGKHFVLVHGACHGGWSWYKLKPLLEGAGHKVTALDLA
ASGIDLRKIE ELQTLHDYTLPLMELMESLSADEKVILVG
HSLGGMNLGLAMEKYPQKIYT AVFLAAFMPDTVHNSSFV
LEKYYERTPAESWLDTQFLPYGSPEEPLTSMF FGPKFLA
HKLYQLCSLEDLALASSLVRPSSLFMEDLAKAKYFTDEGF
GSV KRVYIVCTEDKAIPEEFQRWQIDNIGVTEAIEIKGA
DHMAMLCEPQKLCA ALLEIAHKYN

References

No reference