orysa-q6z307

Oryza sativa (japonica cultivar-group); O.punctata (Red rice); O.meyeriana; O.brachyantha; O.barthii; O.glumipatula; O.meridionalis; O.nivara (Indian wild rice); O.rufipogon (Brownbeard rice); O.glaberrima, lipase class 3-like

Comment

"Other strains: Oryza sativa (japonica cultivar-group)\; Oryza punctata (Red rice)\; Oryza meyeriana var.\; Oryza brachyantha\; Oryza barthii\; Oryza glumipatula\; Oryza meridionalis\; Oryza nivara (Indian wild rice)\; Oryza rufipogon (Brownbeard rice): Oryza glaberrima"

Relationship

Family : Triacylglycerol-lipase-OBL1-like

Block : L

Position in NCBI Life Tree : Oryza sativa

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MAGAGEYGGGGGGGGGFGGDFMVLRPDKGGIGDLFHLLWS
CKVAENAAVD CPIGTEIAERRRRWALFVSLVAQMLLLWT
KKPMALLGGGTEYWMNLLNEN GGSVFMLITNALQGKVKM
PDKSSINYRSCIGLLDTRIDLDEKIKPEDRNY HAALSIM
AAKLAYENELVVRTVVQNHWQMNFVGFYNCWNEFQEDYTT
QAF MVSDKAEDASLAVVAFCGTKPFDTEQWCADVDFSWY
EIPGVGKVHGGFMK ALGLQRNGGWPEQPTGAGDDGGSDK
KPFAYYVIRERLRAFLAENPRARFV VAGHSLGGALAILF
PTVLALHGEEDMLARLHGVYTFGQPRVGDEGLCRFM DGH
LATPVSRYFRFVYCNDIVPRVPYDDTALLFKHFGTCLYFD
SFYKGHV TEEEPNKNYFSLLTVVPKYANAAWELARSFVI
GYVDGPEYGEGWLMRIAR AAGLLLPGLPPHAPQDYVNAT
RLGAASLEPLR

References

No reference