panvg-a0a8t0mxm6

Panicum virgatum (Blackwell switchgrass). AB hydrolase-1 domain-containing protein

Comment

Relationship

Family : TGL-GrainShapeFactor

Block : X

Position in NCBI Life Tree : Panicum virgatum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAAIPAEAPAPGLPPPPPMEQPRRRRRPCVLFSFAAARDR
FLRHRFFSAG LRPFSVRLPSPAGTSTVVHLWAPPRPARR
PVLLLHGFGASATWQWAPYLR SLLAAGLDPIVPDLLFFG
ASSSTLPERSETFQARTVKAAMDGMGVRRFAV VGVSYGG
FVGYRMAAMYPEAVERVVLVSSGVCLEEQDLAAGLFPVAD
VGE AAELLVPRRPAEVRRLVKLTFVRPPPVMPSYFLKDY
INVMGSDHIQEKTE LLYSLINERKLSDLPKIRQPTLIIW
GEQDQVFPMELAHRLERHLGDNSRL VVVKNAGHAANIEK
SKEVCKIIVDYFQEPADSSVSMGGRTSDGGKSVLNY SLR
SEMIYIF

References

No reference