phavu-v7awt2

Phaseolus vulgaris (Kidney bean) (French bean). Abhydrolase_3 domain-containing protein

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MEISMDVPPYLRVHKDGTVERMAGTQVVPAGFDSNTNVVS
KDILVIPETA VTARLYRPNSTPQNAKLPLVLYLHGGAFC
ISSASDPVYHNSLNKLVADSN VVALSLNYRLAPEHPLPA
AYQDSWSAIQWVASQAKAQEDWFRDNVDFERV FLAGDSA
GANIGHYIALKLNNVSKNDFDFKVKGLVMVNPYFWGKEAI
GVE ITDPERKKMVDMWWDFVCPSDKGNDDPLINPFVQEA
PSVEGVACEKVLVI VAEKDILKERGKLYHKMLSNSGWKG
KAEFYETLGEDHVFHIFNPDCDKAK SLIKRIADFINEQT
VNV

References

No reference