phavu-v7beu9

Phaseolus vulgaris (Kidney bean) (French bean). Uncharacterized protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MNILVPLAFLCLAALAPWRVRSQEQRLLVNMTLVHKARAS
GALCLDGSLP AYHLHRGFGAGKDNWLLQFEGGGWCNDLR
SCFERAKTRRGSTRYMTKLEV FSGILSNNATLNPDFYNW
NRVKLRYCDGASFTGDAVFTNKTTTLHFKGQK IWEAIID
DLLPQGLGKARKALLSGCSAGGLATFHHCDRFAKHLPTNA
SVK CLSDAGFFLDERDISLNHTMRFFVKSLVQLQGVEQN
LNRNCTRELYFPDL CFFPQYALKYISTPYFILNSAYDVY
QFHHILVPTSADLHGHWNRCKLNPT ACTADQIDTLQGFR
LDMLGALNPFYINSRRGGLFINSCFAHCQSELQETW FGD
DSPRINDKTIAEAVGDWYFSRNISKEIDCAYPCDGTCHNL
IP

References

No reference