phavu-v7bfg3

Phaseolus vulgaris (Kidney bean) (French bean). Abhydrolase_3 domain-containing protein

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MASTNPKEIVAELPTYIRVFSDGTVERPRESPFVPPSIND
PLTGVSSKDI VISQTPSVSARIYLPKLIPTNDQDHPQNF
PILVYFHGGGFFFESAFSQLY HRYFNTFVSQTNVIVVSV
EYRRAPEHPLPACYHDCWDALKWVASHSTQNN ATNEDPW
LISHGNLQRVFIGGDSAGGNIVHNVAMRAGTEPLPCDVKI
VGA IFSHPYFCSSNPIGSEVVKGGHEQSLAYLVWGFVYP
SAPGGIDNPMVNPL APAAPSLDGLGCSKILVCVASDDKL
RDRGVWYCEGVRKSGWHGELELFEE KGEDHVYHIFHPES
ENAMKLTQRLRLFLQ

References

No reference