phavu-v7c738

Phaseolus vulgaris (Kidney bean) (French bean). Uncharacterized protein

Comment

Relationship

Family : UCP031088

Block : X

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MLLNHVAAGFCWVDPPQPDRNHKTRLASSPFRRRLVAPTS
AAFHGVRMEK KDRKRRSICTADELHRVVVSNSDWKLALW
RYLPSPEAPLRNHPLLLLSGV ATNAIGYDLSPESSFARY
MSAQGFDTWILEVRGAGLSTIGDSLEEDDECL KNLSEID
SAIRDEIGKSSASPARVMGFKDLGSPEVITKFEEMRLTRR
LMD IFTRISENLAGFLNPDLLEGGKNSAIVGQIKDFNRR
LRAIIEGQQLFPAQ ILELQDRFSTTLEEFQKQLQLIVKY
DWDFDHYLEEDVPAAMEYIRAQCQP KDGKLLAIGHSMGG
ILLYAKLSRCYSEGKDSGLASVVTLASSLDYTPSRS SLK
LLLPLAKPAQALNIPAIPVGPLLATVYPLASYPPYVLSWL
NSQISAQ DMMDQKLFEKLVLNNFCTIPAKLLLQLSSAFQ
EGGLRDRSGTFLYKDHLC KINVPVLAIAGDQDLICPPEA
VYETVKLIPEELVTYKVFGELGGPHYAHY DLVGGRLAAD
ELYPCITEFLIQHDML

References

No reference