phavu-v7c8n2

Phaseolus vulgaris (Kidney bean) (French bean). Uncharacterized protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSQRGKSCGGMKLLKQWMFLLVGLVILKWVEGLEDTNVTD
IDMQYVSGKG FYRPLMVGLTLINGAAAKGAVCLDGSLPG
YHFHRGYGSGSNSWLIQLEGG GWCGTIKNCLYSKKTRHG
SSYFMEKQIPFIGILSNKAQENPDFFNWNRIK VRYCDGA
SFSGDSQNAGAGLYFRGQRIWQAAMEDLMSKGMRYAKQAL
LSG CSAGGLATIIHCDEFRELFPRTTRVKCLSDAGLFLD
SVDVSGRRSLRNLF GSVVTLQGVRKSLPRSCTSRLNPIL
CYFPQHLIASVRTPLFLLNAAYDTW QIQASLAPPSADYR
WNWYECRKDYARCSAPQIQYLQGFRNQMLRSTRAFS RSY
KNGLFINSCFAHCQSERQDTWFAHDSPRIGNRMYEDTEKV
YRRVVHR FLLKGTLEKESVYSCYHRNANGTANYVVR

References

No reference