phavu-v7cgb8

Phaseolus vulgaris (Kidney bean) (French bean). Uncharacterized protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MEMLVCGFSIVVTYWGIRVRMVSRGQWLSVLICVVLLLKA
EGVPVGITFV ENAVAKGAVCLDGSAPAYHFHKGSGAGIN
NWIVHFEGGGWCNNVTSCLSR RDTRLGSSKKMDTQLSFS
GFFSNSKKFNQDFYDWNRIKVRYCDGSSFTGD VEAVDPR
TNLHFRGARVFAAVVEDLLAKGMKNAQNAIISGCSAGGLA
AIL NCDRFKALLPRTTKVKCLADAGYFINVKDVSGAQRI
EEFYSQVVQTHGSA KNLPSSCTSRLKPGLCFFPQNVVSQ
ISTPIFFVNAAYDSWQIKNILAPGA ADPHGQWRECKLDI
KNCSPNQLSVMQVFRTDFLRAFGAVGNSPSKGHFID GCY
AHCQTGTQETWLRNDSPVLGNTTIARAVGDWFYDRRAFHQ
IDCAYPC NPTCHNRIFDQNALPDV

References

No reference