phavu-v7cir4

Phaseolus vulgaris (Kidney bean) (French bean). Uncharacterized protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Phaseolus vulgaris

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MEGGRIRQWLNLLVCALLSLMAEASYVPITYLQNAVAKGA
VCLDGSPPGY HFDRGSGTGINNWLVAFEGGGWCNNVTTC
LSRKTNHLGSSKQMAKQIAFS GIMSNRPMFNPDFYNWNR
IKVRYCDGSSFTGDVEAVNPVTKLHFRGARIF AAVMEDL
LAKGMKNARNAIISGCSAGGLTAVLHCDRFKALLPREARV
KCV SDAGYFINARDVTGAYHIQQYFSQVVATHGSARNLP
QSCTSRLTPKLCFF PQYLVSHITTPIFFVNAAYDSWQIK
NILAPGVADPEGHWHSCKLDINNCS PDQLDLMQGFRTEF
LRALTVLGNSSYKGMFIDSCYAHCQTEMQETWLRND SPE
LEKTTIAKAVADWFYERRTFHQIDCPYPCNPTCHNRVLEP
QDNHQGV

References

No reference