9acar-g3msq0

Amblyomma maculatum (Gulf Coast tick) Putative uncharacterized protein

Comment

Relationship

Family : Valacyclovir-hydrolase

Block : X

Position in NCBI Life Tree : Amblyomma maculatum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MNTLSAFARTASRRSLVKLQSTSCSFGFIRCSSDLKPAST
LNPPGFYVQA LNYRIHVETVGNGPRPVVLLPGAIGSTRT
DFLPQLEKLDRKLFTIISWDP PGYGFSRPPERNFPVDFY
HRDARVLAKVMQKLGHRQYSVVGWSDGANTGM ILAAIQP
DCVQKLVAFGGNAYITEEDVQLLEATRNTEKWSERMRASM
EAL YGAEHFRHLWSSYCDFYRDLLQKHRGEVCSNELPHI
HCPTLIIHGGKDPL VPSHHPYYLLQHIAKAKLYVVPDGK
HNLHFKYADEFNKIVTEFLIS

References

No reference