9gamm-n8v8h3

Acinetobacter sp. ANC 3789. 3-oxoadipate enol-lactonase

Comment

Relationship

Family : Carboxymethylbutenolide_lactonase

Block : X

Position in NCBI Life Tree : Acinetobacter sp. ANC 3789

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MITITNRQGKHLSVYVEGLENAPAIVFSNSLGTDHAIWQP
QVAELKKQFK VITYDTRGHSQSDVVAETTVQNLAEDVID
ILDALNIEKAHFCGISMGGLT ALYLGIHHADRFNSITVA
NSAAKIGTAEAWLKRAEAVEQNGLADLVASTH SRWFSSE
FDYQENALAQQTIQSLANTPAQGYANACRALAHEDLREQI
ANI QIPTLLIAGKFDPITTVADAEFMQQRIAHSQLNILP
ASHLSNIEQPEGFT QALQRFIEVIS

References

No reference