9homo-a0a0d0did8

Paxillus rubicundulus Ve08.2h10. Carboxylic ester hydrolase

Comment

Relationship

Family : Fungal_carboxylesterase_lipase

Block : C

Position in NCBI Life Tree : Paxillus rubicundulus Ve08.2h10

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVVLWALLSSLLLASPVASWPLVPSTDPLMHLSRAVPVFD
RGWANYCSFS PYTPEFLCPRRGSNMPISISTPLGTAQGV
GDTATVNRFTVKYASAQRWQP STVATTWELPNGSTNVSA
LPLMCPQPYVDDSSFSEDCLSMILYVPTSLKS VSGVPTL
MWIHGGSFMVGSATDPGLDGSALAEATDSIVVVIQYRLGA
LGF VAPNGQTNLGLKDTVNALQLLRKVLPSFGGDPSKIT
VAGQSSGANMIRAL LAVPSAQSLFQSAILQSDPMDYGFL
SISDQQQLQDYFVSILPCKPSDTSC LDAMSLDEIVTTVG
LNQFDNAFLVVPAATQAEPMRVVNDGTFITSTLDST TPF
PKVTKPIILSNVADEAGLTIYGNFPDPVPEAEYEAIVNAS
FGESRYQ TLMGSQLYRVDASTTDYRPQLEVLATDSVWRC
ATWTFARNWVSSGGRAYV GLYTLGASYPGNSAVPYCIQP
GVVCHQDDIEIVFGTAPNPTSAQSALITE MQARYKSFLY
TGNPNPCDSSYANWQAAGTSNVNAILLGSSGLAPVGACTP
SFWGQSVPYDYQVYDI

References

No reference