9homo-a0a0d0dja5

Paxillus rubicundulus Ve08.2h10. Carboxylic ester hydrolase

Comment

Relationship

Family : Fungal_carboxylesterase_lipase

Block : C

Position in NCBI Life Tree : Paxillus rubicundulus Ve08.2h10

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKHTPLSLLLAESVARASARPYGEHSPPTVTLDSATVTGV
SSGSVNEFLG IPFAQPPIGDLRFQLPQSLPPYNTSFSAT
TYGPACPQQTAQFPAVSGLPA ETLDYLALLSSPPAPPSA
EDCLTLNVITPADAAHESKLPVVVWIYGGGFE QGATSTF
NGTVIVDKAISLGVPAIYVSMNYRLNAFGFLASQEVKDAG
IGN LGLRDQRLALYWVQKYICRFGGDPTKVTIWGQSAGA
ISVGLQMVANDGNS DGLFRAAFMQSGSPPPVGDILQGQK
YYDALVSETGCSSASDTLQCLREVP YGALLGAMNQSPNI
FSYQSLIISWQPRADGVFLTDDPQKLIQRGLVADVP FVT
GDCDDEGTMFSFSTLNVTTISPLRTDTQFEEYIRTYWFPN
ATSTTIK EVMRYYPANISQGSPFDTRMLNALTPQFKRIA
ALQGDAVFQAPRRFFLQN RLGKQALWTYASKRLKTVPYL
GAFHGSDMLDVEGGQDIASYLVRFVSNLD PNGGTDLYWP
QYTTAEPTILELLDGPIPQALTEDTYRVDAMKFLTKVTLA
YPL

References

No reference