9myco-a0a0h5rmz2

Mycobacterium neworleansense Transmembrane protein

Comment

Relationship

Family : Abhydrolase_9

Block : X

Position in NCBI Life Tree : Mycobacterium neworleansense

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MLRASRGLPIPSSVVSAARTLHPVGLSVALLFFAWSMTPS
LLPRPWYLQA VATGISVGIGYGLGCATAWAVCRCGINPQ
WSARTRRIGWWTLAGATAAVV PAFLVLGSWWQQILRDLI
GMPRTERSFYLVVLLIAVVIAVALLAVGRGLR WATNRLA
QTGGRVVPAPAARLAALVIVVVLAVMGLDGALHRGLLSMA
ERS AKVADKSTADGVVRPGAPERSGSPASAQAWDTLGRE
GRTFVAGGPSAQQI SAVTGVPALTPIRVYAGRTSAGSVE
GIAEQVVAELRRTRAFERKVLAVVT TTGRGWVNPNVAAA
LEYVNAGDTAIASMQYSFLPSALSFIADRETPPEAG QAL
FEAVHRVWAALPEVQRPKLVVFGESLGSFGGQSAFASGAD
MVARTDG ALLVGTPNFAQPWSRITAHRDAGSLERLPVVD
GGRHIRFASRTSDVNLAG PWEFPRVVFWQHASDPITWWS
FDLLLHRPDWLREPLGPDVDPGMRWLPFV TFWQVTLDMI
FSADVPYGYGHAFGPDAADLWIDILAPRGWDPALTQRVQD
AIAGS

References

No reference