9myco-a0a0h5rzb5

Mycobacterium neworleansense Transmembrane protein

Comment

Relationship

Family : Abhydrolase_9

Block : X

Position in NCBI Life Tree : Mycobacterium neworleansense

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MTAETLDERHPLLRWAWSLVRLDFTGIAVGALFFCLSLTP
SLLPRDWLFA GLIGGINAAIGYGIGVLLGKGLYRFGLRN
RTWWPPSKRTLYWLKVLVVAG AVTACVLMLIPAAAWQRQ
VSSLMGMEGPATPGYLRTLIIAVAVGAALIAT ARMLRDA
VRLLARLFIRRWHLHREVAQFIGTAIVVVLVVTLVNGVLY
RGF LAGASRVFQPQNTTTREGISQPSESERSGSPASFAA
WDSLGFQGRNFVAT GPRAAELEKLNGAPAREPIRVYAGL
HTADDDDQRIAVLLSELERTHAFER KLLVIVPTTGTGWV
NPVAARALELMYNGDTAMVGMQYSYLPSWISFMGDR EKS
MNNGRLMIDAIHARWEQLPPERRPKLVLYGESLGSMAGQG
AFSWLPD ISRMGFSSVLWVGPPNASPLWRGLTVRRDPGT
PQVRPRYDNGRTVRFSEA ANAAEIAEDTAAPWEGTRVLF
LQHPSDPIIWWSTDLLFSEPDWLVEPPGT DRTASMRWYP
IITFWQVAADITNASSVPAGHGHNYGESVLDGWAAVAPPE
GWTPGDTERIRVALEKTEANDGPEN

References

No reference