9myco-a0a100vzt2

Mycobacterium brisbanense, Uncharacterized protein

Comment

Relationship

Family : Duf_1023

Block : X

Position in NCBI Life Tree : Mycobacterium brisbanense

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

LVYLEKPADPSQMIPAATSVGDPFTADHVSVTVPGVSGTT
RGTIAGMTGE AAQLRNEAIDIARQVGDSQNVATVAWVGY
QPPPNLGDSGMLSDDLAQAGA PKLTSFLHDIDAASKNPG
HTTALFGHSYGSLTSGIALKEGASAYVDNAVM YGSPGFE
ATSPAQLGMNDNNFFVMAAPDDPINPIGALAPLHGWGSDP
NDI INDDGHLRFRFQHLETSAGDTPIPGYESKTGASGHS
EYGRDAEQRMTGYN LAAILLNRPDLAVKETPLSW

References

No reference