9plat-a0a1i8hd50.1

Macrostomum lignano Uncharacterized protein

Comment

"a0a1i8hd50.1 complex seqeunce N-term 1033 aa extension unrelated excluded here followed by a repeated fragment a0a1i8hd50.2"

Relationship

Family : ACHE

Block : C

Position in NCBI Life Tree : Macrostomum lignano

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MLRIGLLPQWLLVAAMSAVLLQPMGSEAQAAAPRHTVNLT
NGSSIQGFTS TVRSRTVWSYLGIPYAKPPVGALRFKPSV
PLDSPIGNSSMPYDASKKPQT CYYWPLLPQEFEKTNPAL
MMWWNNTEMSEDCLYLNVWSPTSDSAAGKAVM VWIYGGG
FFGGSSSLEVYDGAVLAATGDVVVASMQYRTGALGFMFLD
DTE APGNAGLYDQYRAIQWIHENIRAFGGDNSQITLFGE
SAGAVSVSYHLLSP YTQGYFRRAILNSGSAIAWWASEDR
STGWSKSLALADLAKCRPDYTRDGI KIANCLRQVTPELL
QQHTWNAMSNVFKARKQSYSRYYQQNLRRYQESGNS AAI
ANLETALFFDVPFKPVFGSDFLPKVPVEQLRDSKMNNDVK
KADLLLG VVKDEGTFWIMYALGGIFMHKNGNWNIPFWWG
QPLDQQLNRDYDFLVQNR TGLDMDKDPYNLVARYFIVNN
THLDSLVTEAVSFEYQVPSKLFGRTSWTA KETLDALDDL
TSDRSFKCPTVDFAEMYAQMLGMNGSNSIWMYSFEQRSQM
LPLPEWTGVLHGYELDYVFGTPFNQRFGPEFYNFTTSES
QLSDDVMKFWT NFARTGNPNQFNSSSLSGEAWPAYNLSD
RSYIVLKSRLSTASSFRIGQNL RKRQCDFLRYQVPNIVR
QIGARYDCSSDRRSEPTMGPASSANALQGKLAF IIL

References

No reference