9plat-a0a267eec7

Macrostomum lignano. Uncharacterized protein

Comment

Relationship

Family : Pancreatic_lipase

Block : L

Position in NCBI Life Tree : Macrostomum lignano

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKCRLPLLLLSTLLLTFAPLSTLSIDLDEYVEPDIPDYGD
EDIDEDERFL VKTSVCYGDLGCFSIKGKYFNLLHRPVVV
VPQSPEVIGTKFLLFTRRNPA SPAELHYKNAKSVLRSRF
SNRRPTKLVIHGFLGKGVMGWMNRIRQAMLKR VDCNLIQ
VGWAGGSVTLYNQATSNTRVVGAVVARMLRWLHSRFGVDL
DNV HVIGFSLGGHIAGYVGRRLRERGTPLGRITGLDPAG
PYFEGTDPVVRLDP TDAKFVDAIHTDGALWRVGLPLLNG
GFGIQSPVGHVDFFVNGGRHQPGCS SLGACDHSRAPQLY
IDTLKTAKSKAFSAFPCDNYDKFMAGDCGSHCPSGG CPV
MGLDAEKYKARLTGSRLPHRYYLLTGPCAPYSVVHYHVTL
RLSSKSP SGRTGGLKVQLSSGGKQCGPVKLAVDERRLSP
GSRQRGVFGCTGWWSLAA SAPAKLEVSWTDESTFGSWFG
YRIKLDSAVLTEMVSGRAHRYCGYGSFKG GDWVSGRRC

References

No reference