9plat-a0a267f7i4

Macrostomum lignano. Uncharacterized protein

Comment

Relationship

Family : Pancreatic_lipase

Block : L

Position in NCBI Life Tree : Macrostomum lignano

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MRVLALICVLALCNQWAVGMDLRRQTRFIPMKVCYDGLGC
FSTGGNFYDL WRRPIQLLPQSPDRIRPIFALYTRRNIVA
GQRIVYNNKASVTGSNFNPRQ PTKFIIHGFLDPGDVAWM
VDMRKALLLHGDYNVIQVDWSNGNQLPYTQAT ANTRVVG
ALIAQLIMWLETQFGANREQFHLLGHSLGSHIAGYAGERL
TGS RRLGRITGMDPAGPYFENTHPEVRLDPTDARFVDAI
HTDGDSLLSSISLK GGFGMMQAVGHVDFYANGGKKQPDC
TQNPITNIIIDGIIEGTKWTIACDH LRVLPMVTSTIEHQ
QGNYKAFPCDSYEKFKAGRCSSCGSVGCAQMGIKAN EWN
PNGRTNVKMFLDTAGKAPFESTGPR

References

No reference