9rosa-w9qzg2

Morus notabilis. Uncharacterized protein

Comment

Relationship

Family : Plant_lipase_EDS1-like

Block : L

Position in NCBI Life Tree : Morus notabilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVTEELINKAFSEAMAAHKYPDEEFLEKRGSSEVIFSFPG
YWSVKDWYSE GAFGETGIDSAFFPSLRSIGNNEYAVVNK
AFQERFKLVAERSQLRNRVEE AVRDNMQIVFTGHSSGGP
IAVLAAIWLLEDYAKQKSQTLISPLCLTFGSP LIGNHIF
SHALRRENWSRYFFHFVTRSDIVPRVFLSPLPSNEQHFQL
LLE HFRLQSLSTSRGSHGAPKFAYDFFINVMRNALTLTS
HVACKLMESSNLLF ETVTSFIKLSPYRPFGTYVFSNGNG
KVVTLKNSDAVLQLLFYSCQPSSED GRDIAQRSFTEHFA
YENELLQSFNGYISLDGEIESTDECNDMINKAADDI GLS
TRGRLCLLAAGESETQKKKNKDKMDSKKGPTEKALKEIEN
YKNKCAV HKVGYYDSFKLQKNEEDFKANVKRLELAGIFD
EMIEMLKGYKLPDQFEGL KEWIDIGTRYRRLVEPLDIAN
YYRHAKNEDTGNYMKNGRPKRYRYTQRWR EHAEKMREES
SGESCFWAEVEELWTLMKKQPSEQKTANFGARALKVQKEV
SQWGQDKVIQTDVFLNGSTFVKWWESLSFPNKLGEIEQL
LNGLKN

References

No reference