9rosa-w9r1a9

Morus notabilis. Chlorophyllase-2

Comment

"only c-term Chlorophyllase 113->"

Relationship

Family : Chlorophyllase_Plant

Block : L

Position in NCBI Life Tree : Morus notabilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

SSLTSSTVNSNVYESGKYSTVIQKVEAETRIPVPPPKPLL
IAMPSEGGEF PLLVFSHGYLLYNSFYSQLLQHVASHGFI
LYTVAGPDSSDEIKSTAQVTN WLSKGLQYLLPQQVKPNL
SKVALAGHSRGGKTSFALALSKETITTLKFSA LIGIDPV
DGMDKGKQTPPPVLTYVPHSFDLGMPVMVVGSGLGEVKRN
PLF PPCAPKGVNHEDFFKECREPACYFVVKDYGHVDMLD
DETKGIRGKTTYCL CKNGKTREPMRKFVGGVVIAFMKAY
LEGDKRSLMAIRERSSDGDLPVELK TIEFLL

References

No reference