9rosa-w9rfb0

Morus notabilis, Putative uncharacterized protein

Comment

Relationship

Family : Duf_1350

Block : X

Position in NCBI Life Tree : Morus notabilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MELLATCSTSSSSSSSLLGAKHTFPATQLNRRRSNLQFNG
NRATAVKSAS SSSAALNGYAGSSRDFGANNNNATITTKN
STRFYTRMDSCLVIPPPTGTK PRAVVKFLGGAFIGAAPE
LTYSYVIELLAKEGFLVISVPYNVTFDHADAA KQVYERF
NACLDSVLASGLPQANLTPAQLSDLPLFSVGHSNGALLQV
LTG SYFCERIPKANVIISYNNRPATEAVPYFEQLGPLVR
QIMPVVEASPVYSM ARSASGDAWKVLIDAAGAIIPNNDQ
ETLISVTKFVDQLPSVFNEVTQGIS EFKPTPSENRDRCK
NSYNIKHTLLVKFSFDTIDETDLLEETLKPRVDFIG GTL
EKVELSGNHITPCIQEPKWQVGEVYTPADAIAQGLKTLSL
NDSRVLV RTISNWFRRLEA

References

No reference