9rosa-w9sjy4

Morus notabilis, Putative uncharacterized protein

Comment

Relationship

Family : Duf_1350

Block : X

Position in NCBI Life Tree : Morus notabilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MHLHPPFHELQSQTQSRTIGFSYSAASRRGCGGVGHTYRR
SRTRIYYNSD EPTRRQPTGIQLYSEIERLLTDTVKQSQD
GWGGLRDWTEVEGAWVLKPRS SEPKFVVHFVGGIFVGAA
PQLAYRFFLERLSQKDVLVIATPYASGFDYFF IADEVQF
KFDRCLRFLRDTVSDLPTFGIGHSLGSVIHLLIGSRYAVQ
RNG NVLMAFNNKEASSAIPLFSPVLVPMAQSVGPILSQI
ASSPTIRLGEMQNF LESVAEMTLKQLGNLSPPIMKQVLP
LVEQLPPLYMDLVNGKEDFTPKPEE TRRLIKSYYGISRN
LLVKFKDDSIDETSTLAQVLSSESAISSMLDMSIRL LPG
DHALPLQQAIPDVPPAMADAVNRGSEFLANLSVGTPWETV
AKEVGNT LGTDSRILRAEISKDIDLLVDVIASWMASNTG
QKFLRP

References

No reference