9rosa-w9sn51

Morus notabilis. Uncharacterized protein

Comment

Relationship

Family : Maspardin-ACP33-SPG21_like

Block : X

Position in NCBI Life Tree : Morus notabilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKGAFSAPGDYIYFKSQVPLHKIPIGTKQWRYYDFGPKVV
PPLICLPGTA GTADVYYKQIMSLSMKGYRIISVDIPRVW
NHHEWIQAFEKFLDAIDVHHI HLYGTSLGGFLAQLFAQH
RPRRVRSLVLSNSFLDTCSFSAAMPWASIVSW TPSFLLK
RYVLTGIRDGPHEPFIADSVDFVVSQVETLSREDLASRLT
LTV DAASVGSLLLSDSLITIMDTNDYCAIPQQLKDQLCE
RYPGARRAYLKSGG DFPFLSRPDEVNLHLQLHLRRVGVE
ARPDLVRSNPREGNGGGNPSEKNDK QEDPDDTSKDDQGT
SENSSAQNQPPLAPETSESHSLDGQLDNAKIWHLGF MKK
QHIVSLPTQILLQVTWEIVSLHFMPLYMGTMYIILNNSWK
FRQAV

References

No reference