9sphn-q1nhq9

Sphingomonas sp. SKA58 esterase d

Comment

Relationship

Family : A85-EsteraseD-FGH

Block : X

Position in NCBI Life Tree : Sphingomonas sp. SKA58

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTIETVSTNQSFGGVQGVYRHASSATGTDMMFSVFVPPHE
EGATLPVVWY LSGLTCTHANVTEKGEYRRLCSELGLIFV
APDTSPRGEGVADDPDGAYDF GLGAGFYVDATQEPYSQH
YRMWSYVTQELPDIVADHFPVDRDRQSIMGHS MGGHGAL
TIGLAYPDRFKAISAFAPIVAPSQVPWGQKALDGYLGDDR
AAW RKHDAVAMIEDGARCGALLVDQGSADNFLDDQLKAH
LLAAACEAAGIDLT LHLQPGYDHSYYFISTFMADHLRWH
AERL

References

No reference