Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bace-b3cg29

Bacteroides intestinalis DSM 17393 Acetyl xylan esterase (AXE1)

Comment
only c-term Pfam A AXE1 127 436


Relationship
Family|Acetyl-esterase_deacetylase
Block| X
Position in NCBI Life Tree|Bacteroides intestinalis DSM 17393
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Bacteroidia: N E > Bacteroidales: N E > Bacteroidaceae: N E > Bacteroides: N E > Bacteroides intestinalis: N E > Bacteroides intestinalis DSM 17393: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ABJL02000008
1 UniProt : B3CG29
1 UniProt : B3CG29
1 Interpro : B3CG29
1 Pfam : B3CG29
1 PIRSF : B3CG29
1 SUPERFAM : B3CG29
Sequence
Graphical view for this peptide sequence: 9bace-b3cg29
Colored MSA for Acetyl-esterase_deacetylase (raw)
KIQPYTQMPKDFKEFWENNKAEAAKYPLTYTKKLAEEYCTDKVDCYLIKL
MLNNRGQCIYGYLFYPKNAVKGSCPVVLCPPGAGIKTIKEPLRHKYYAEE
GCIRFEIEIHGLNPEMSAEEFKEISNAFNGRENGYLNNGLENRDNYYMKR
VYLGCVRSIDLLTSLPEWDGKNVIVQGGSQGGALALITTGLDSRVTACVA
NHPALSDMAGYKAGRAGGYPHFFRVEGMDTPDKLKTMAYYDVVNFARMIK
VPTYITWGYNDDTCPPTTSYAVYNVLDCPKEALITPINEHWTSDATEYGQ
LKWILRHLL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

KIQPYTQMPKDFKEFWENNKAEAAKYPLTYTKKLAEEYCTDKVDCYLIKL
MLNNRGQCIYGYLFYPKNAVKGSCPVVLCPPGAGIKTIKEPLRHKYYAEE
GCIRFEIEIHGLNPEMSAEEFKEISNAFNGRENGYLNNGLENRDNYYMKR
VYLGCVRSIDLLTSLPEWDGKNVIVQGGSQGGALALITTGLDSRVTACVA
NHPALSDMAGYKAGRAGGYPHFFRVEGMDTPDKLKTMAYYDVVNFARMIK
VPTYITWGYNDDTCPPTTSYAVYNVLDCPKEALITPINEHWTSDATEYGQ
LKWILRHLL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer