Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-l0wcp3

Alcanivorax hongdengensis A-11-3. Haloalkane dehalogenase

Relationship
Family|Haloalkane_dehalogenase-HLD1
Block| X
Position in NCBI Life Tree|Alcanivorax hongdengensis A-11-3
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Oceanospirillales: N E > Alcanivoracaceae: N E > Alcanivorax: N E > Alcanivorax hongdengensis: N E > Alcanivorax hongdengensis A-11-3: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AMRJ01000024
1 UniProt : L0WCP3
1 UniProt : L0WCP3
1 Interpro : L0WCP3
1 Pfam : L0WCP3
1 PIRSF : L0WCP3
1 SUPERFAM : L0WCP3
Sequence
Graphical view for this peptide sequence: 9gamm-l0wcp3
Colored MSA for Haloalkane_dehalogenase-HLD1 (raw)
MKVLRTPESRFSRLLDYPFEPHYVDVNGLRMHYVDEGPRDGKPVLMLHGE
PSWSYLYRHMIPVCAAAGHRVIAPDLIGFGKSDKPADRNAYNYQSHMDWL
QSLLDQLDLTDITLVCQDWGSLLGLRLAAENDARFRAIVVGNGMLPTGDQ
PVPRAFQLWKNFALYSPWFPIARIINSGTFRTLGPDERRAYDAPFPGKAY
KAGARMFPKLVPVTPDDPASDANRRAWQVLEQWRKPFLTTFSNGDPITRG
GDRYMQERIPGAAGQPHQTLTGGHFLQEDSPVAFANAINALLAGLDQAPS
GSGED
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKVLRTPESRFSRLLDYPFEPHYVDVNGLRMHYVDEGPRDGKPVLMLHGE
PSWSYLYRHMIPVCAAAGHRVIAPDLIGFGKSDKPADRNAYNYQSHMDWL
QSLLDQLDLTDITLVCQDWGSLLGLRLAAENDARFRAIVVGNGMLPTGDQ
PVPRAFQLWKNFALYSPWFPIARIINSGTFRTLGPDERRAYDAPFPGKAY
KAGARMFPKLVPVTPDDPASDANRRAWQVLEQWRKPFLTTFSNGDPITRG
GDRYMQERIPGAAGQPHQTLTGGHFLQEDSPVAFANAINALLAGLDQAPS
GSGED


Reference
    Title: Genome sequence of the alkane-degrading bacterium Alcanivorax hongdengensis type strain A-11-3
    Lai Q, Shao Z
    Ref: Journal of Bacteriology, 194:6972, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer