Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-w2v1w4

Legionella oakridgensis. Esterase/lipase

Comment
Other strains: Legionella oakridgensis (RV-2-2007; ATCC 33761 = DSM 21215)


Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|Legionella oakridgensis RV-2-2007
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Legionellales: N E > Legionellaceae: N E > Legionella: N E > Legionella oakridgensis: N E > Legionella oakridgensis RV-2-2007: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AZYK01000095, CP004006
1 UniProt : W0BI08
1 UniProt : W0BI08
1 Interpro : W0BI08
1 Pfam : W0BI08
1 PIRSF : W0BI08
1 SUPERFAM : W0BI08
Sequence
Graphical view for this peptide sequence: 9gamm-w2v1w4
Colored MSA for CarbLipBact_2 (raw)
MNFDDFRYMWRGKTQQALSNQQAALLAPIDHQNGKKERALLLLHGFSSSP
AVFRELLPTLFNLYDTVVCPALPGHADSIETFAKTQASEWLTAAEQSCEE
LLRNYQMVDVMGLSLGGLLACHLANRFPLHHLYLLAPALALRFKITIALA
VARLLHGLGFRRLRNRAGNLYTSRASELAYRQLPISTIIEILSLIQNYQF
VPPTCPVDLFLGRYDEVVQSTLVADYFANLPNVHIHWLNHSAHVLPLDGD
IDTIIAHLKGNQAKITQATS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNFDDFRYMWRGKTQQALSNQQAALLAPIDHQNGKKERALLLLHGFSSSP
AVFRELLPTLFNLYDTVVCPALPGHADSIETFAKTQASEWLTAAEQSCEE
LLRNYQMVDVMGLSLGGLLACHLANRFPLHHLYLLAPALALRFKITIALA
VARLLHGLGFRRLRNRAGNLYTSRASELAYRQLPISTIIEILSLIQNYQF
VPPTCPVDLFLGRYDEVVQSTLVADYFANLPNVHIHWLNHSAHVLPLDGD
IDTIIAHLKGNQAKITQATS


Reference
    Title: Legionella oakridgensis ATCC 33761 genome sequence and phenotypic characterization reveals its replication capacity in amoebae
    Brzuszkiewicz E, Schulz T, Rydzewski K, Daniel R, Gillmaier N, Dittmann C, Holland G, Schunder E, Lautner M and Heuner K <2 more author(s)>
    Ref: Int J Med Microbiol, 303:514, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer