Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9zzzz-a0a160vb37

ecological metagenomes hydrothermal vent metagenome Esterase/lipase

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|hydrothermal vent metagenome
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> unclassified sequences: N E > metagenomes: N E > ecological metagenomes: N E > hydrothermal vent metagenome: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : A0A160VB37
1 Interpro : A0A160VB37
1 Pfam : A0A160VB37
1 PIRSF : A0A160VB37
1 SUPERFAM : A0A160VB37
Sequence
Graphical view for this peptide sequence: 9zzzz-a0a160vb37
Colored MSA for Hormone-sensitive_lipase_like (raw)
MPLDPQVIQVMDSVAALGLPAAHTVSPEEARANGKKRPRSPGPEVAKVED
RSIPGPDGDVPIRIYTPGGNGPFPILVWYHGGGWVVGDLEQADGSCRNLC
VGGQCVVVSVDYRLAPETKFPGNAEDCWSATIWAVENAASINADGSRLAV
GGDSAGGNLAAAMCLMAADRGGPEISLQLLIYPVTEVNFTTDSYNQNAEG
YSLTKVTMQWYWDHYLSNEDDALNPYAAPLQAKSLVGQPPALVITAEFDP
LCDEGEAYAKRLSEAGVETTATRYDGVIHGFFTMGAVVDKGQQAVDEASA
ALRKAFARSGASSAAD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPLDPQVIQVMDSVAALGLPAAHTVSPEEARANGKKRPRSPGPEVAKVED
RSIPGPDGDVPIRIYTPGGNGPFPILVWYHGGGWVVGDLEQADGSCRNLC
VGGQCVVVSVDYRLAPETKFPGNAEDCWSATIWAVENAASINADGSRLAV
GGDSAGGNLAAAMCLMAADRGGPEISLQLLIYPVTEVNFTTDSYNQNAEG
YSLTKVTMQWYWDHYLSNEDDALNPYAAPLQAKSLVGQPPALVITAEFDP
LCDEGEAYAKRLSEAGVETTATRYDGVIHGFFTMGAVVDKGQQAVDEASA
ALRKAFARSGASSAAD



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer