Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspor-axe1

Aspergillus oryzae; Aspergillus flavus Acetylxylan esterase A AoAXE

Comment
Other strains: Aspergillus oryzae; Aspergillus flavus (and strain ATCC 200026/FGSC A1120/NRRL 3357/JC12722/SRRC 167)


Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Aspergillus oryzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus oryzae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AB167976, AP007171, AM921700
3 UniProt : Q75P26, A9JPE6, B8NBI2
3 UniProt : Q75P26, A9JPE6, B8NBI2
3 Interpro : Q75P26, A9JPE6, B8NBI2
3 Pfam : Q75P26, A9JPE6, B8NBI2
3 PIRSF : Q75P26, A9JPE6, B8NBI2
3 SUPERFAM : Q75P26, A9JPE6, B8NBI2
Sequence
Graphical view for this peptide sequence: aspor-axe1
Colored MSA for Esterase_phb (raw)
MILLSYLLTYLLCALTCSARAIHNGRSLIPRAGSLEQVTDFGDNPSNVKM
YIYVPTNLASNPGIIVAIHYCTGTAQAYYQGSPYAQLAETHGFIVIYPES
PYEGTCWDVSSQATLTHNGGGNSNSIANMVTWTTKQYNADSSKVFVTGTS
SGAMMTNVMAATYPNLFAAGVAYAGVPAGCFLSTADQPDAWNSTCAQGQS
ITTPEHWASIAEAMYPDYSGSRPKMQIYHGNVDTTLYPQNYEETCKQWAG
VFGYNYDAPESTESNTPEANWSRTTWGPNLQGILAGGVGHNIQIHGDEDM
KWFGFTN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MILLSYLLTYLLCALTCSARAIHNGRSLIPRAGSLEQVTDFGDNPSNVKM
YIYVPTNLASNPGIIVAIHYCTGTAQAYYQGSPYAQLAETHGFIVIYPES
PYEGTCWDVSSQATLTHNGGGNSNSIANMVTWTTKQYNADSSKVFVTGTS
SGAMMTNVMAATYPNLFAAGVAYAGVPAGCFLSTADQPDAWNSTCAQGQS
ITTPEHWASIAEAMYPDYSGSRPKMQIYHGNVDTTLYPQNYEETCKQWAG
VFGYNYDAPESTESNTPEANWSRTTWGPNLQGILAGGVGHNIQIHGDEDM
KWFGFTN


References
    Title: Identification of two aflatrem biosynthesis gene loci in Aspergillus flavus and metabolic engineering of Penicillium paxilli to elucidate their function
    Nicholson MJ, Koulman A, Monahan BJ, Pritchard BL, Payne GA, Scott B
    Ref: Applied Environmental Microbiology, 75:7469, 2009 : PubMed

            

    Title: An Aspergillus oryzae acetyl xylan esterase: molecular cloning and characteristics of recombinant enzyme expressed in Pichia pastoris
    Koseki T, Miwa Y, Akao T, Akita O, Hashizume K
    Ref: J Biotechnol, 121:381, 2006 : PubMed

            

    Title: Genome sequencing and analysis of Aspergillus oryzae
    Machida M, Asai K, Sano M, Tanaka T, Kumagai T, Terai G, Kusumoto K, Arima T, Akita O and Kikuchi H <54 more author(s)>
    Ref: Nature, 438:1157, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer