9acar-a0a1e1x6g0

Amblyomma aureolatum. Carboxylic ester hydrolase

Comment

Relationship

Family : ACHE

Block : C

Position in NCBI Life Tree : Amblyomma aureolatum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MLLLLVAGVPVRPAAARKGHQHQQQQHHRPDPLVVHTAKG
PVRGLATESP TGKPVDVFYGIPYAKPPVGRYRFRHPKPN
DPWKGVFDATVKPKSCFQTVD TFFGDFRGSLMWNANTNM
SEDCLTLNVWVPRPRPNASHPAAVLVWIYGGG FYSGTST
LDVYDGRALVSEERVLLVSMNYRVASLGFLCLDHPEVPGN
AGL FDQLMALQWVQENIAAFGGNPKNVTLFGESAGAVSA
SMHLLSPLSRDLFS QAILQSGTAIAPWGVHDRQTALQSA
LRLAETLHCPHDERHLEAMLACLRE QEPETIVNSETGNF
GVVEFPFVPVVDGAFLDESPQESLAARNFKKTRLLL GSN
RDEGTYFLIYYLTELFRRDESVYLGREDFVRAVRELNPLV
GELAQQA IVFQYTDWLNPEDPIKNRDAVDKIVGDYHFTC
SVVEWAHQYALAGSQVYA YYFTHRSSQSAWPQWMGVIHG
EEIAFLFGEPLNKTLGYRSDEQALSRRMM RYWANFAKTG
NPSLSEEGHWERIYWPVHTAHGKEYLTLAVNSSLVGYGHR
AKYCAFWQQFLPRLVNLS

References

Title : The Distinct Transcriptional Response of the Midgut of Amblyomma sculptum and Amblyomma aureolatum Ticks to Rickettsia rickettsii Correlates to Their Differences in Susceptibility to Infection - Martins_2017_Front.Cell.Infect.Microbiol_7_129
Author(s) : Martins LA , Galletti M , Ribeiro JM , Fujita A , Costa FB , Labruna MB , Daffre S , Fogaca AC
Ref : Front Cell Infect Microbiol , 7 :129 , 2017
Abstract : Martins_2017_Front.Cell.Infect.Microbiol_7_129
ESTHER : Martins_2017_Front.Cell.Infect.Microbiol_7_129
PubMedSearch : Martins_2017_Front.Cell.Infect.Microbiol_7_129
PubMedID: 28503490
Gene_locus related to this paper: 9acar-a0a1e1x324 , 9acar-a0a1e1x355 , 9acar-a0a1e1x374 , 9acar-a0a1e1x4z0 , 9acar-a0a1e1x663 , 9acar-a0a1e1x6g0 , 9acar-g3mm97