Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: azovi-q4itf2

Azotobacter vinelandii AvOP esterase, phb depolymerase

Comment
Other strains: Azotobacter vinelandii (strain DJ / ATCC BAA-1303; AvOP; CA6)


Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Azotobacter vinelandii AvOP
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Azotobacter group: N E > Azotobacter: N E > Azotobacter vinelandii: N E > Azotobacter vinelandii DJ: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AAAU03000016, WP_012701883, ACO79501
2 UniProt : C1DPT0, M9YQ09
2 Interpro : C1DPT0, M9YQ09
2 Pfam : C1DPT0, M9YQ09
2 PIRSF : C1DPT0, M9YQ09
2 SUPERFAM : C1DPT0, M9YQ09
Sequence
Graphical view for this peptide sequence: azovi-q4itf2
Colored MSA for Esterase_phb (raw)
MNARRNSDLLEATRLTRSGQLLEATALIQRALGAPRPAANASPKSRAGET
VIEGCFRVIDSGPFAADSTAQDIDRDVAGTQDGPEPVTEPFFPSSRFGAA
LREKLFKFRGPAPVFDPILPQQAPKAIPEGAQFITGSYTNPAGTRSYKLY
VPSGYDGQPLPLVVMLHGCTQSPDDFAAGTRMNEFAEKEPCLVLYPAQST
AANCSKCWNWFNPSDQCADQGEPSLIAGMTRDVAACYKVDPRRIYVAGLS
AGGAMATTMAMTYPDLYAAAGIHSGLPHAAAHDLPSAFAAMQQGAKCAGR
QTTSVGNNRAPARPVPIIVFHGDQDTTVHPGNGDQVIAQFSPTASHPAAQ
PKTGANPSAKVERGQVPNGHAYTRTVYRHPSGSPHVEQWTIHGAGHAWSG
GSTHGSYTDPRGPDATKEMLRFFLAHPFQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNARRNSDLLEATRLTRSGQLLEATALIQRALGAPRPAANASPKSRAGET
VIEGCFRVIDSGPFAADSTAQDIDRDVAGTQDGPEPVTEPFFPSSRFGAA
LREKLFKFRGPAPVFDPILPQQAPKAIPEGAQFITGSYTNPAGTRSYKLY
VPSGYDGQPLPLVVMLHGCTQSPDDFAAGTRMNEFAEKEPCLVLYPAQST
AANCSKCWNWFNPSDQCADQGEPSLIAGMTRDVAACYKVDPRRIYVAGLS
AGGAMATTMAMTYPDLYAAAGIHSGLPHAAAHDLPSAFAAMQQGAKCAGR
QTTSVGNNRAPARPVPIIVFHGDQDTTVHPGNGDQVIAQFSPTASHPAAQ
PKTGANPSAKVERGQVPNGHAYTRTVYRHPSGSPHVEQWTIHGAGHAWSG
GSTHGSYTDPRGPDATKEMLRFFLAHPFQ



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer