Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: chlgu-a0a3l8scm5

Chloebia gouldiae (Gouldian finch) (Erythrura gouldiae)Lonchura striata domestica (Bengalese finch). Uncharacterized protein

Comment
Other strains: Chloebia gouldiae (Gouldian finch) (Erythrura gouldiae); Lonchura striata domestica (Bengalese finch)


Relationship
Family|SERHL
Block| X
Position in NCBI Life Tree|Chloebia gouldiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Archelosauria: N E > Archosauria: N E > Dinosauria: N E > Saurischia: N E > Theropoda: N E > Coelurosauria: N E > Aves: N E > Neognathae: N E > Passeriformes: N E > Passeroidea: N E > Estrildidae: N E > Erythrura: N E > Erythrura gouldiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : QUSF01000028, MUZQ01000080
2 UniProt : A0A3L8SCM5, A0A218UZU7
2 UniProt : A0A3L8SCM5, A0A218UZU7
2 Interpro : A0A3L8SCM5, A0A218UZU7
2 Pfam : A0A3L8SCM5, A0A218UZU7
2 PIRSF : A0A3L8SCM5, A0A218UZU7
2 SUPERFAM : A0A3L8SCM5, A0A218UZU7
Sequence
Graphical view for this peptide sequence: chlgu-a0a3l8scm5
Colored MSA for SERHL (raw)
METGTPAALLTINETPGTYSKYVTLQGHHPVSGMFSELKFPVPWGHVAAK
AWGPLEGHPVLCLHGWLDNANTFDKLIPLLPRGCYYVAMDFSGHGLSSHR
PAGCSYHFLDYVTDVRRVAAALQWRRFTLMGHSMGGAVAGMFCFLYPEMV
DKLILLESLGFLLAPEDTEAWLKSKRRVIDRLLSLEAKQQTPKARSPEAA
LQRLLEANSHLTAEGGAILLQRGATETPAGLVYNRDMRARTQNREFFTVE
QCIKLLQKIQDRVLIIVSQDGLLVPHNLSSRNHFVKALQEAFKSTFKEHI
QLAEVPGSHSVHLNEPEVVSGIISNFLTAQNTRARL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

METGTPAALLTINETPGTYSKYVTLQGHHPVSGMFSELKFPVPWGHVAAK
AWGPLEGHPVLCLHGWLDNANTFDKLIPLLPRGCYYVAMDFSGHGLSSHR
PAGCSYHFLDYVTDVRRVAAALQWRRFTLMGHSMGGAVAGMFCFLYPEMV
DKLILLESLGFLLAPEDTEAWLKSKRRVIDRLLSLEAKQQTPKARSPEAA
LQRLLEANSHLTAEGGAILLQRGATETPAGLVYNRDMRARTQNREFFTVE
QCIKLLQKIQDRVLIIVSQDGLLVPHNLSSRNHFVKALQEAFKSTFKEHI
QLAEVPGSHSVHLNEPEVVSGIISNFLTAQNTRARL


Reference
    Title: A non-coding region near Follistatin controls head colour polymorphism in the Gouldian finch
    Toomey MB, Marques CI, Andrade P, Araujo PM, Sabatino S, Gazda MA, Afonso S, Lopes RJ, Corbo JC, Carneiro M
    Ref: Proc Biol Sci, 285:, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer