Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cyap7-b7ki60

Cyanothece sp. Alpha/beta hydrolase fold protein

Comment
Other strains: Cyanothece sp. (strain PCC 7424; PCC 8801; PCC 8802) (Synechococcus sp. (strain ATCC 29155; PCC 8801 RF-1; RF-2)) Alpha/beta hydrolase fold protein


Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Cyanothece sp. PCC 7424
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Oscillatoriophycideae: N E > Oscillatoriales: N E > Cyanothecaceae: N E > Cyanothece: N E > Cyanothece sp. PCC 7424: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CP001291, CP001287, CP001701
2 UniProt : B7KI60, B7K4U1
2 UniProt : B7KI60, B7K4U1
2 Interpro : B7KI60, B7K4U1
2 Pfam : B7KI60, B7K4U1
2 PIRSF : B7KI60, B7K4U1
2 SUPERFAM : B7KI60, B7K4U1
Sequence
Graphical view for this peptide sequence: cyap7-b7ki60
Colored MSA for Epoxide_hydrolase (raw)
MNLLQEGWRNGFIKTNGINLHYVTAGEGKLMLMLHGFPEFWYSWRHQIPE
FSQDHKVVALDLRGYNDSDKPQSQDAYKLQEIVADIEGVITALGYDNCIL
VGHDWGGAIAWQFAYTYPNKVEKLIILNLPHPAKFSEGIRNPQQLMKSWY
AFFFQTPFFPEWILQANDYQLIESGFKMMAVDKNIFTQKDLNAYKDAAAK
RGALTGMLNYYRSTAQGLMTRSPKDWGILEVPTLMIWGEDDAALGKELTY
GTEVYVKDFTIKYIPNCSHWVQQERPQLVNQYIREFLRSF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNLLQEGWRNGFIKTNGINLHYVTAGEGKLMLMLHGFPEFWYSWRHQIPE
FSQDHKVVALDLRGYNDSDKPQSQDAYKLQEIVADIEGVITALGYDNCIL
VGHDWGGAIAWQFAYTYPNKVEKLIILNLPHPAKFSEGIRNPQQLMKSWY
AFFFQTPFFPEWILQANDYQLIESGFKMMAVDKNIFTQKDLNAYKDAAAK
RGALTGMLNYYRSTAQGLMTRSPKDWGILEVPTLMIWGEDDAALGKELTY
GTEVYVKDFTIKYIPNCSHWVQQERPQLVNQYIREFLRSF



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer