Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: nipbr-ACHEB

Nippostrongylus brasiliensis (Rat hookworm) acetylcholinesterase B precursor, partial cds

Comment
There is a difference between the Trembl genbank entry and the publication of Hussein et al. codon 186 is missing (LLDQTAL instead of LLDQQTAL) corrected in ESTHER in order to be consitent with the subsequent numbering of mutations


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Nippostrongylus brasiliensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Nematoda: N E > Chromadorea: N E > Rhabditida: N E > Strongylida: N E > Trichostrongyloidea: N E > Heligmonellidae: N E > Nippostrongylinae: N E > Nippostrongylus: N E > Nippostrongylus brasiliensis: N E


Molecular evidence
Database
14 mutations: Table (e.g. : F345A, F345Y, M301A/F345A ... more)
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF052508
1 Ncbi-nid : 2961646
1 UniProt : O61587
1 Interpro : O61587
1 Pfam : O61587
1 PIRSF : O61587
1 SUPERFAM : O61587
Sequence
Graphical view for this peptide sequence: nipbr-ACHEB
Colored MSA for ACHE (raw)
DDGPTVVLSSGTKIHGIYMDVNGQTVSAYLGVPFATAERFAMPTLTETYG
GDIEALQLSKTCFQTKDETYPGFDGAEMWNPPTELSEDCLSLNIWVPENP
DGNVIVWIYGGGFFSGSPSLALYNGSVLAGKTNAVVVNVNYRVGPFGFFY
LGANSKAPGNVGLLDQQTALKWIHNNIEYFKGDPSKVTLFGESAGGTSVT
SHLLAPDSHSLFSKIIVNSGSIHNVWATRSPCTMLHISMKTAKALGCVEN
YEIKPIREAEGRCTVLGADADTIYECMKEKTPEKIQSEGNSDAIYAEMLP
MEWPFGPITYDDNYFKGEVRRKLFSGEFKTDVSAIFGTVKDEGTFWLPYY
LSESGFSFFPDQDSDSEANAAKIDEANYTASMQAFEGYFGKSSKAIEILK
EGFKDLGDVQTMYRDGVARFVGDFFFTCNLVEFVDHVTQKISEAYMYYFK
ARSSANPWPKWMGVMHGYEIEYEFGYPFINSTAYKEVDKDRTISEEFMQL
IKEFVKNGKFDDEWPKYEGGKVMVIEDDASRKIEDKDIQQKYCKIINDAR
QALIDEAKGN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

DDGPTVVLSSGTKIHGIYMDVNGQTVSAYLGVPFATAERFAMPTLTETYG
GDIEALQLSKTCFQTKDETYPGFDGAEMWNPPTELSEDCLSLNIWVPENP
DGNVIVWIYGGGFFSGSPSLALYNGSVLAGKTNAVVVNVNYRVGPFGFFY
LGANSKAPGNVGLLDQQTALKWIHNNIEYFKGDPSKVTLFGESAGGTSVT
SHLLAPDSHSLFSKIIVNSGSIHNVWATRSPCTMLHISMKTAKALGCVEN
YEIKPIREAEGRCTVLGADADTIYECMKEKTPEKIQSEGNSDAIYAEMLP
MEWPFGPITYDDNYFKGEVRRKLFSGEFKTDVSAIFGTVKDEGTFWLPYY
LSESGFSFFPDQDSDSEANAAKIDEANYTASMQAFEGYFGKSSKAIEILK
EGFKDLGDVQTMYRDGVARFVGDFFFTCNLVEFVDHVTQKISEAYMYYFK
ARSSANPWPKWMGVMHGYEIEYEFGYPFINSTAYKEVDKDRTISEEFMQL
IKEFVKNGKFDDEWPKYEGGKVMVIEDDASRKIEDKDIQQKYCKIINDAR
QALIDEAKGN


References
3 more
    Title: High yield production of a mutant Nippostrongylus brasiliensis acetylcholinesterase in Pichia pastoris and its purification
    Richter S, Nieveler J, Schulze H, Bachmann TT, Schmid RD
    Ref: Biotechnol Bioeng, 93:1017, 2006 : PubMed

            

    Title: Insecticide detection through protein engineering of Nippostrongylus brasiliensis acetylcholinesterase B
    Schulze H, Muench SB, Villatte F, Schmid RD, Bachmann TT
    Ref: Analytical Chemistry, 77:5823, 2005 : PubMed

            

    Title: Cloning, expression, and properties of a nonneuronal secreted acetylcholinesterase from the parasitic nematode Nippostrongylus brasiliensis
    Hussein AS, Chacon MR, Smith AM, Tosado-Acevedo R, Selkirk ME
    Ref: Journal of Biological Chemistry, 274:9312, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer