Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: terss-e8v4j6

Terriglobus saanensis (strain ATCC BAA-1853 / DSM 23119 / SP1PR4). Uncharacterized protein

Relationship
Family|ABHD18
Block| X
Position in NCBI Life Tree|Terriglobus saanensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Acidobacteria: N E > Acidobacteriia: N E > Acidobacteriales: N E > Acidobacteriaceae: N E > Terriglobus: N E > Terriglobus saanensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002467
1 UniProt : E8V4J6
1 UniProt : E8V4J6
1 Interpro : E8V4J6
1 Pfam : E8V4J6
1 PIRSF : E8V4J6
1 SUPERFAM : E8V4J6
Sequence
Graphical view for this peptide sequence: terss-e8v4j6
Colored MSA for ABHD18 (raw)
MFGKLYSQWMFKWETALTTRDTNRIVRPMEWGFDWLSDFSATAASATEQD
ADALEKMLRINDEIVANGEAFYGYDTPTDFRLEERFPDLFPTNVRPETLK
QAAQVRADAESGKLDKAQFLRFTSPVRTKHPENDQVNARWYPEPEDKRKP
GPRQAIIVMPQWNADAFSHNALCSIFNKFGVAGLRLSKPYHDVRRPAELE
RSDYAVSSNVGRTISACRQAVVDIRSCVDWLESQGYEQIGVLGTSLGSCY
AFMAAAFDSRLQVCVFNHASTRFGDVVWTGQSTRHVREAFEQVGMGQAEV
RRVFMGISPESVMDRYAAETSRQTLVIHATYDLTFLREFSLEVLTAFRQR
GVDFVSKVLPCGHYTTGETPYKYMDGWWMGSFVYKAYKRLRERAAKPAAS
AA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFGKLYSQWMFKWETALTTRDTNRIVRPMEWGFDWLSDFSATAASATEQD
ADALEKMLRINDEIVANGEAFYGYDTPTDFRLEERFPDLFPTNVRPETLK
QAAQVRADAESGKLDKAQFLRFTSPVRTKHPENDQVNARWYPEPEDKRKP
GPRQAIIVMPQWNADAFSHNALCSIFNKFGVAGLRLSKPYHDVRRPAELE
RSDYAVSSNVGRTISACRQAVVDIRSCVDWLESQGYEQIGVLGTSLGSCY
AFMAAAFDSRLQVCVFNHASTRFGDVVWTGQSTRHVREAFEQVGMGQAEV
RRVFMGISPESVMDRYAAETSRQTLVIHATYDLTFLREFSLEVLTAFRQR
GVDFVSKVLPCGHYTTGETPYKYMDGWWMGSFVYKAYKRLRERAAKPAAS
AA


Reference
    Title: Complete genome sequence of Terriglobus saanensis type strain SP1PR4(T), an Acidobacteria from tundra soil
    Rawat SR, Mannisto MK, Starovoytov V, Goodwin L, Nolan M, Hauser L, Land M, Davenport KW, Woyke T, Haggblom MM
    Ref: Stand Genomic Sci, 7:59, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer