alilo-a0a1b9ntc2

Aliivibrio logei; Aliivibrio salmonicida; Aliivibrio sifiae ; Aliivibrio sp. Esterase

Comment

"Other strains: Aliivibrio logei (Vibrio logei, strain LFI1238))\; Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida)\; Aliivibrio sifiae\; Aliivibrio sp."

Relationship

Family : Bacterial_lip_FamI.8

Block : X

Position in NCBI Life Tree : Aliivibrio logei

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MISSLFSRFAFIGSLTILGACSQSTTDANYLASESLPNYS
QTSFQQYIDE TKLWLADHRVFKSDDIEKELMVNLPFEIK
PNKPNGKGVLLVHGLGDSPFS FIDVAQHLADKGYLVRSI
LLPGHGSKVADLMLPSLEDWQNVVHHHTQLLK AQTDEVW
LGGYSTGANLVTSEALKDDDITGLLLFSPAFKPGSSTVKF
AKI ASYFMTWADQDPETNPIRYNSLPMHGAAVYYDTAKI
VQQDLKDKNYTKPV FMITSEGDRVIDTKFATTVFETQFT
NARNHLVWQGENTFPATNATTFSMN RPDLKIVDGSHMGL
LFSPNNPEYGEKGVVRICSNGQTEEQELACEEGADV WFS
SYGIREEGKIFARLTYNPYFEQSMEILDSVMNVSASN

References

No reference