alisl-b6eif0

Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238)) Putative esterase

Comment

Relationship

Family : Duf_1100-R

Block : X

Position in NCBI Life Tree : Aliivibrio salmonicida

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTQPESENLSVKLFKTNKQALETSCLVPYLPSSLEQISKN
SERNWYRELR RPQWIWQGVYPIELEGILSKMASSDKDRT
KPEWLDTVTGYRAGNWAYEWI NAGMEHQKCASDLEGNEA
AERLFKASLYFSIAGYPHIKGDNLATQAQVLA SKAYDMA
AKQTSHRIEKILVPYDGRKITCYLHLPNTEKPLPVVIVSG
GMD SLQTDMWSLYRDYLAPNNMAMLTLDMPSIGHSSYWP
LTEDSSCLHQAVLN YLPHIPWVDRFHAAVMGFRFGGNVA
LRLSFLEPNKLKTCVALGAPIHQVL SNSTQLKKMPKMYL
DILASRLAKQVVDVNSLTGQMKAWSLKFQGFLSGGR KTS
VSILAIGLAGDPVSPKSDNKLAAMFSKYGKGVELKNKTLH
SGYEDAL NQMIEWIKEEMKH

References

No reference