alisl-b6ej57

Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238)) Acyl-CoA thioester hydrolase

Comment

Relationship

Family : MenH_SHCHC

Block : X

Position in NCBI Life Tree : Aliivibrio salmonicida

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MPLYSKLIEPIESTTQPCVVFLHGLLGSIKEWDQIASVIA
QSHPVLLIDL PGHGKSQSVELEESTGFEQACQLIIEQCH
SSPYQEFVLVGYSLGGRLAMY LSAFFQLPNDITLRGLCV
EGGNFGLISKEEKHIRWQNDTMWAERFEQQPI ADVLDNW
YQQKVFSSLNPEQRQVLVAKRSDNLGLSIGMMLRSTSLAK
QPY LLNELHRCTIPMLYICGEAGQKFQHLAEQSQLTYQI
IAQAGHNAHVEQPE RFTHVLNTFLQQWT

References

No reference