alisl-b6ejm5

Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238)) LFI1238)) Putative phospholipase

Comment

"only c-term Pfam A Abhydrolase_6 370 624 n-term patatin"

Relationship

Family : Monoglyceridelipase_lysophospholip

Block : X

Position in NCBI Life Tree : Aliivibrio salmonicida

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

VIVNGRNESYWKYKEAILELSQYFNIYTYDHRGQGESGRI
TQDHELGHVD DFHDYVMDLYIFMEKVVRPNLEGECFMLS
HSMGGAVTAQYLSKFDHPVTA SAATSPMFGVYIPGKAYG
LKTQTLNLLDVLASKPNYALGQSHFKKVEYDD NVLTHSK
IRYQMFVELFENMPNLRLGGPSTHWITESIKAGKKCIAEA
HKI KIPMLILQAGDDLVVSNVAQRSFHENSHLCHLETIP
DSYHDMLIEDDKHR DIVLRKLINFFSSDYKFY

References

No reference