alisl-bioh

Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238)) Biotin synthesis protein BioH

Comment

Relationship

Family : BioH

Block : X

Position in NCBI Life Tree : Aliivibrio salmonicida

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTTSLYWQTEGEGSDLVLIHGWGMNGAVWQPIVEKLSSQY
RVHTVDLSGY GYSAELGSADFDEMVAQVLAQAPEKSAWL
GWSLGGLIATQAALTAPDRVS QLITVASSPRFAAEKGWR
GIKSAVLSQFTEQLKEDFTLTVERFMTLQAMG SPNAKQD
IKQVKRAVLSRPAPNPSALATGLTILADIDLRESLSQLTM
PVC RMYGRLDGLVPIKVAHDMDAFIPHSTKVVFEQASHA
PFISHSDEFITELH RFLQPEDEFLI

References

No reference